PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P12410_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 742aa    MW: 80938.5 Da    PI: 6.609
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P12410_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.51.4e-20109164156
                            TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            +++ +++t++q++eLe+lF+ +++p++++r eL+++l L+ rqVk+WFqNrR+++k
  GSMUA_Achr3P12410_001 109 KKRHHRHTPQQIQELEALFKDCPHPDEKQRLELSRRLCLESRQVKFWFQNRRTQMK 164
                            566689***********************************************999 PP

2START174.85.3e-552705101206
                            HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
                  START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                            ela++a++el+++a+ eep+W  ss    + +n++ ++++f +  +     + +ea+r++++v  +++ lve+l+d + +W ++++  
  GSMUA_Achr3P12410_001 270 ELALAAMEELMSMAQMEEPLWLASSqggpKALNYEQYRRTFRPIAGispvgSVSEASRETRIVSIDSVALVETLMDAS-RWVHMFPsi 356
                            5899*************************************9866699******************************.********* PP

                            ..EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEE CS
                  START  78 ..kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliep 156
                              ka+t+e issg      galqlm+ael +lsplv+ R++ f+R+++q+ +g+w++vdv+vd  +      s++ +++lpSg+l+++
  GSMUA_Achr3P12410_001 357 vaKATTTELISSGvsgtrdGALQLMQAELHVLSPLVAvREVSFLRFCKQHAEGVWAVVDVAVDGIRAD---LSSANCRRLPSGCLVQD 441
                            ****************************************************************9995...47999999********* PP

                            ECTCE...................EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                  START 157 ksngh...................skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                            +++g+                   + vtwveh+++++ ++h l+r+l++sg+a+ga +wvatlqrqce+
  GSMUA_Achr3P12410_001 442 MPDGYskiflllprdlsldqhfclCVVTWVEHAEYDEGQVHHLYRPLLRSGQAFGAGRWVATLQRQCEC 510
                            *******************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.27E-2098166IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.9E-2199166IPR009057Homeodomain-like
PROSITE profilePS5007117.508106166IPR001356Homeobox domain
SMARTSM003892.0E-15107170IPR001356Homeobox domain
CDDcd000861.17E-17109166No hitNo description
PfamPF000464.5E-18109164IPR001356Homeobox domain
PROSITE patternPS000270141164IPR017970Homeobox, conserved site
PROSITE profilePS5084837.86261513IPR002913START domain
SuperFamilySSF559614.29E-25262511No hitNo description
CDDcd088751.16E-96265509No hitNo description
PfamPF018521.7E-46270510IPR002913START domain
SMARTSM002344.3E-33270510IPR002913START domain
SuperFamilySSF559613.02E-14533707No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    Send to blast
MSFGGLSDGR SGGALAYGNA AMTAGELSPP QLISQRLPNS AFISPRLSLG LQTNVDGQID  60
MSRMAGVGGG SDVGSAKRSK DDENESRSES DNLEAISGDD VDQENPRKKK RHHRHTPQQI  120
QELEALFKDC PHPDEKQRLE LSRRLCLESR QVKFWFQNRR TQMKTQIERF ENTKLRQEND  180
KMRAANMAIR EATQSAACKN CGGPVMLGNV SVERLQLRLE NARLKEELDR LSVLEIGVGN  240
NIFAGFNSVV APTISALPDY LPGDRSMLLE LALAAMEELM SMAQMEEPLW LASSQGGPKA  300
LNYEQYRRTF RPIAGISPVG SVSEASRETR IVSIDSVALV ETLMDASRWV HMFPSIVAKA  360
TTTELISSGV SGTRDGALQL MQAELHVLSP LVAVREVSFL RFCKQHAEGV WAVVDVAVDG  420
IRADLSSANC RRLPSGCLVQ DMPDGYSKIF LLLPRDLSLD QHFCLCVVTW VEHAEYDEGQ  480
VHHLYRPLLR SGQAFGAGRW VATLQRQCEC LATLVSSTAV ARDETASITA SGQRSMLKLA  540
RRMTNAFCAG VCASPAHGWS KLASETIGED VRVMSRMSVN VPGEPAGLVL SVATSVWIPA  600
PPKRLFDFLC ETRFRSKWDI LSNGGPMCEM AHIAKGQEAA NRVSLIWATA TNASQTSMML  660
LQETYTDASG AMLVYAPVDI PAMHLVMNGG DSAHVALLPS GFAIILVNGQ PTEKLTAETV  720
DTVNGLISCT VQKIKAAVHS EI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009391954.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLM0SE080.0M0SE08_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P12410_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein